PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00004.1.g06860.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 700aa    MW: 74041.7 Da    PI: 4.9233
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00004.1.g06860.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS264.73.1e-813406992374
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                    + L+++A+a + g++  a+ +Larl+++  p g +p+ R a++++eAL + l++      +  +++ ts+ +++ +laa+
  Zjn_sc00004.1.g06860.1.sm.mk 340 LDDLVAAAKAAEVGNFVGARLILARLNQQLPPIGgKPFLRSASCLKEALLTALND-----GNNGSSRLTSPLDVALKLAAY 415
                                   5789*************************777776********************.....56667777777889******* PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRp....egppslRiTgvgspesgske 156
                                   k fs++sP+l+f+++ta qa+l+++     ++v iiDfd++ G+QW ++lq+La R+     + p++++T+++s++s++  
  Zjn_sc00004.1.g06860.1.sm.mk 416 KSFSDISPVLQFANFTATQALLDEITCTtaSCVRIIDFDLGVGGQWSSFLQELAHRRdtggVSLPTFKLTAFVSSASHHPL 496
                                   ***********************98766569***********************9997765569***************** PP

                          GRAS 157 eleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsP 236
                                   el+ t+e+L++fA+ lg+pf f+++   +le++++ eL  ++ +E +aV+l ++         +l+     +L+lvk+l P
  Zjn_sc00004.1.g06860.1.sm.mk 497 ELHLTRENLSQFANDLGIPFGFTAI---NLETFDPAELIASTaDEFVAVSLPVSCSIRT---PPLPM----LLQLVKQLAP 567
                                   ************************9...99*****99977777*********9665443...45555....********** PP

                          GRAS 237 kvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWre 317
                                   k+vv +++  d ++ +F ++f+++++ ++ l+dsl+a   +++++++k+Er+l++++++++v  +      r e+++ Wr 
  Zjn_sc00004.1.g06860.1.sm.mk 568 KIVVAIDHGNDQSDLPFSQHFMNCFQSCMFLLDSLDAA-RTDADTASKIERFLIQPRVEDAVLGRR-----RVEKAMAWRT 642
                                   ***********************************998.5777******************98554.....6799****** PP

                          GRAS 318 rleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   ++++aGF pvpls+ a++qa++ll++v+++g++ve+    l l+W++ +Lvs+SaWr
  Zjn_sc00004.1.g06860.1.sm.mk 643 AFTSAGFVPVPLSNLAEAQADCLLKRVQFRGFHVEKCGTDLALYWQRGELVSISAWR 699
                                   ********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.931313679IPR005202Transcription factor GRAS
PfamPF035141.1E-78340699IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MSAAPFIAEG NGISAGSIEA LLCWPADKGG GLVEPTSVLD SGWSPSPPNS TSLMSSSQGG  60
GAADSAGVAA AAASENSERA ASGERSGGGD GRKEEEEEWT GGDLPPVPGT LGVGFNGEEA  120
GWDAMLSDAA AVAGQEQTFL NWILADPSDV EPPALQQQQQ LLGNAAGFGF PASDSPGFSL  180
KHHPGGGASA SDPSSAGARS VSSSKATSTF GLLPTEAALL PPPATTLPFD DGADIKRALH  240
GVPTPNLLLN QHHPMPAASF VMPLPSFPDH HQQPHLPPPP KRHHSMPDNL FLLNNQLPPP  300
LPQCLPFPTL HTAAPFQLQP SLQPPLDAMK TTATAQQQLL DDLVAAAKAA EVGNFVGARL  360
ILARLNQQLP PIGGKPFLRS ASCLKEALLT ALNDGNNGSS RLTSPLDVAL KLAAYKSFSD  420
ISPVLQFANF TATQALLDEI TCTTASCVRI IDFDLGVGGQ WSSFLQELAH RRDTGGVSLP  480
TFKLTAFVSS ASHHPLELHL TRENLSQFAN DLGIPFGFTA INLETFDPAE LIASTADEFV  540
AVSLPVSCSI RTPPLPMLLQ LVKQLAPKIV VAIDHGNDQS DLPFSQHFMN CFQSCMFLLD  600
SLDAARTDAD TASKIERFLI QPRVEDAVLG RRRVEKAMAW RTAFTSAGFV PVPLSNLAEA  660
QADCLLKRVQ FRGFHVEKCG TDLALYWQRG ELVSISAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2341569980375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002446917.10.0hypothetical protein SORBIDRAFT_06g024820
TrEMBLC5YDJ70.0C5YDJ7_SORBI; Putative uncharacterized protein Sb06g024820
STRINGSb06g024820.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20203796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.15e-85GRAS family protein